DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and col11a2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001005799.1 Gene:col11a2 / 448277 XenbaseID:XB-GENE-12564499 Length:340 Species:Xenopus tropicalis


Alignment Length:250 Identity:86/250 - (34%)
Similarity:120/250 - (48%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GIPIATRLLRPLPASVQTFPLALATPPDD-TPRNCYDEKH------GQVRIRIAPDMEPFFASCD 148
            |||   .:|.|........|...:.||.: ..:||.:..:      |...|.:..: :|....||
 Frog    99 GIP---GMLGPRGEKGDMGPPGPSGPPGERAAKNCMELLNYGVLFTGWYTIYLDGN-KPIKVLCD 159

  Fly   149 QKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKS 213
            .....|||:|...|.|||.||.:||::||.|||:..|||::|.:.:||||:|.:.:|...::...
 Frog   160 MDTDGGGWIVFQRRVDGSVDFYRDWKSYKQGFGSQLSEFWLGNENIHRLTSSGNFQLRFDLEDFD 224

  Fly   214 GEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQ-NCARTHAG 277
            ....:|.|..|.:..||:.|.|.......|.|||||..|..:.|:|.|.|||...: |||..:.|
 Frog   225 NNRTYATYSQFRLEPESQNYTLRFREFTGGPAGDSLFTHKDRAFSTKDADNDPASKTNCAERYKG 289

  Fly   278 AWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPLK 332
            |||| ..|:.|.|.|.:..  ||......|:.|..| .|...||....|.:||.|
 Frog   290 AWWY-ESCYHSCLNGEYMR--GQHDKADGGVHWAKF-RGVNYSLKVSEMKLRPEK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 76/219 (35%)
col11a2NP_001005799.1 Collagen 45..110 CDD:189968 5/13 (38%)
FReD 128..338 CDD:238040 75/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.