DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and CG9593

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster


Alignment Length:351 Identity:93/351 - (26%)
Similarity:151/351 - (43%) Gaps:88/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NATSNLPGKHFSVIMRNSAEPFLLAENDTASCPVSTLAGLAARVQFMTDEL---QNLKTELNELQ 79
            :|...:||::.|     ..:|               ||.|:.|:..:.:.|   :.:.|.|.|| 
  Fly    72 DAVVQVPGRYSS-----KEDP---------------LAVLSERLNLLLERLNQEERISTNLLEL- 115

  Fly    80 GLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDDTPR---------NCYDEKHGQVRIR 135
               :|:         :|::.:. |:..||.|..| |...|.|:         :|::...| ||:.
  Fly   116 ---KEW---------STKVCQE-PSPSQTLPKEL-TEEKDEPKVDFYQPAKSDCHELDEG-VRVD 165

  Fly   136 -----IAPDMEPF----------FASCDQKVRDG-GWMVIAYR---FDGSEDFNKDWQNYKAGFG 181
                 :.|:....          ||:      || .|.||..|   ||..|:||:.|..|:||||
  Fly   166 GVYRFLVPERNEVQRDLYERYCAFAT------DGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFG 224

  Fly   182 ALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAG 246
            .|:.:|:.|.:..|::...:.|||.|.:::......:|.|..|.:.|||..|.|.|.|.::|...
  Fly   225 NLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLP 289

  Fly   247 DSLRYHAGKKFTTFDQDND---DNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGI 308
            |:|..|....|:|:|:..:   .....|...:.|.||:.| |.:.||.|    ::|........|
  Fly   290 DALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDR-CTQCNLNG----EHGVHQRASPAI 349

  Fly   309 LWKSFLPG---PTGSLSYVRMLIRPL 331
            :|.::..|   |..|    ||:|||:
  Fly   350 IWMNWRTGTDKPKSS----RMMIRPV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 70/245 (29%)
CG9593NP_650493.2 FReD 150..371 CDD:238040 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446491
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.