DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and mfap4.1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001315274.1 Gene:mfap4.1 / 405825 ZFINID:ZDB-GENE-040426-2246 Length:242 Species:Danio rerio


Alignment Length:232 Identity:83/232 - (35%)
Similarity:122/232 - (52%) Gaps:16/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 ALATPPDDTPRNCYD-EKHGQVR---IRIAPDME-PFFASCDQKVRD------GGWMVIAYRFDG 165
            |||:.....|.:|.| .|.|:..   ..|.|..| |.:..| |.:.|      |||.||..|.||
Zfish    14 ALASDCTSMPFDCSDIYKSGETLSGVYTIYPAGETPVWVYC-QMLSDGKDEENGGWTVIQRRMDG 77

  Fly   166 SEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSES 230
            |.:|.:.|::||.|||.:..|:::||:.|::||..:...|.:.::...|...||.|..||:|.|.
Zfish    78 SVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCEC 142

  Fly   231 EKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQ 295
            |.|.|.|.|...|.|||||..|.|.||:|||:|.|...:|||:...||:||| .|..:|....: 
Zfish   143 EGYKLQVSGFTDGGAGDSLSGHNGVKFSTFDKDQDTYDKNCAKEFLGAFWYG-SCHTTNPNAVY- 205

  Fly   296 SKYGQEIGYFK-GILWKSFLPGPTGSLSYVRMLIRPL 331
             .:|::..:.. |:.|.::....|.|:..:.|.|:.:
Zfish   206 -LWGEDATHHAIGVCWYTWKGTHTVSMKIISMKIKQM 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 80/223 (36%)
mfap4.1NP_001315274.1 FReD 23..239 CDD:238040 79/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.