DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and CG10359

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster


Alignment Length:294 Identity:114/294 - (38%)
Similarity:155/294 - (52%) Gaps:39/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAGLAARVQFMTDELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTF--PLAL--A 114
            ||..|..|:.:..|:.||...:.....||     ||.|       ||..|.....|  |..|  .
  Fly   210 LASTALSVRSVQVEVANLSRAIRRQSRLI-----QGKG-------LRSTPGQQPIFYGPSGLNGP 262

  Fly   115 TPPDDTPRNC---YDEKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNY 176
            |.....|.:|   :...||.:::::.|:.|.|:.|||:     .|.||..|.....:|.:.|.:|
  Fly   263 TATRQLPSSCSYSFLSNHGILKVQLTPESESFYVSCDE-----DWTVILSRTSDDVNFERGWLDY 322

  Fly   177 KAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAY 241
            :.|||.|..:|||||:|||.||:|..|||.|:|:..||...:|.|..|:||||.|.|.|.:||.:
  Fly   323 RDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKF 387

  Fly   242 KGD----AGDSLRYHAGKKFTTFDQDNDDNGQ-NCARTHAGAWWYGRECFESNLFG--TFQSKYG 299
            :.:    |||||.||||.||:|.|||||:..: |||..|.||.|: ..|.:|||||  |.|::.|
  Fly   388 QDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWF-NNCAKSNLFGEYTTQNQPG 451

  Fly   300 QEIGYFKGILWKSFLPGPTGSLSYVRMLIRPLKK 333
            :     .||.|.:|  ....||..||.:|||:.:
  Fly   452 E-----TGIWWDTF--SGQNSLKRVRWMIRPISE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 94/221 (43%)
CG10359NP_001137882.1 FReD 267..476 CDD:238040 94/221 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
87.850

Return to query results.
Submit another query.