DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and tnr

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_919364.1 Gene:tnr / 369191 ZFINID:ZDB-GENE-030804-1 Length:1350 Species:Danio rerio


Alignment Length:274 Identity:97/274 - (35%)
Similarity:138/274 - (50%) Gaps:48/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LQGLIEEYKNQGTGIPIATRLLRPLPASV----------QTFPLALATPPDDTPRNCYDEKH--- 129
            |:||.|.     |...:..::.|.|..||          :.||         ||:||  .:|   
Zfish  1089 LEGLAET-----TEYTVRLQVARGLETSVIVSTSFTTGNRLFP---------TPQNC--AQHLLN 1137

  Fly   130 -----GQVRIRIAPDM-EPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFF 188
                 |...|.:..|: :.....||.....|||:|...|.:|..||::.|.:||.|||:|..||:
Zfish  1138 GETLGGIYTIYVNRDLSQGVQVYCDMTTDGGGWIVFQRRQNGLTDFSRKWTDYKIGFGSLEDEFW 1202

  Fly   189 IGLDKLHRLTNSEHHELLIIMKKKSGEER-FALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYH 252
            :|||.:|::.....:||.|.|  |.|:|. :|.||.||||.....|.|.: |.|.|.|||||.||
Zfish  1203 LGLDNIHKIAAQGRYELRIDM--KDGQESVYANYDRFSIGDSKSLYKLRI-GEYSGTAGDSLSYH 1264

  Fly   253 AGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTF-QSKYGQEIGYFKGILWKSFLPG 316
            ..:.|:|.|:|||....|||.::.||||| :.|..:||.|.: :|::.|.|.::.   ||    |
Zfish  1265 QSRPFSTKDKDNDIAVTNCALSYKGAWWY-KNCHRANLNGKYGESRHSQGINWYH---WK----G 1321

  Fly   317 PTGSLSYVRMLIRP 330
            ...|:.:|.|.:||
Zfish  1322 HEFSIPFVEMKMRP 1335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 86/223 (39%)
tnrNP_919364.1 EGF_2 199..225 CDD:285248
EB 234..283 CDD:279949
EGF_2 294..318 CDD:285248
fn3 323..401 CDD:278470
fn3 411..490 CDD:278470
fn3 500..579 CDD:278470
FN3 590..674 CDD:238020
fn3 682..754 CDD:278470
fn3 771..849 CDD:278470
FN3 859..935 CDD:214495
fn3 949..1019 CDD:278470
fn3 1035..1103 CDD:278470 5/18 (28%)
FReD 1126..1336 CDD:238040 87/232 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.