DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Angptl4

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_954546.1 Gene:Angptl4 / 362850 RGDID:735058 Length:405 Species:Rattus norvegicus


Alignment Length:295 Identity:93/295 - (31%)
Similarity:139/295 - (47%) Gaps:60/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQNLKTELNEL------QGLIEEYKN-------QGTGI-PIATRLLRPLPASVQTFPLALATPPD 118
            :|||:::::.|      .|:.:..:.       |..|: |.||||.||                 
  Rat   136 IQNLQSQIDLLTPTHLDNGVDKTSRGKRLPKMAQLIGLTPNATRLHRP----------------- 183

  Fly   119 DTPRNCYD-----EKHGQVRIRIAP-DMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYK 177
              ||:|.:     |:|..: .:|.| ...||..:|:. ..||||.||..|.:||.|||:.|:.||
  Rat   184 --PRDCQELFQEGERHSGL-FQIQPLGSPPFLVNCEM-TSDGGWTVIQRRLNGSVDFNQSWEAYK 244

  Fly   178 AGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYV----- 237
            .|||....||::||:|:|.:|.....:|.:.::...|..:...:. ..:|.|...|.|.:     
  Rat   245 DGFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQDWDGNAKLLQFP-IHLGGEDTAYSLQLTEPTA 308

  Fly   238 --LGAYK-GDAGDSLRYHAGKKFTTFDQDNDDNGQ-NCARTHAGAWWYGRECFESNLFGT-FQSK 297
              |||.. ...|.||      .|:|:|||:|..|. |||::.:|.||:| .|..|||.|. |.|.
  Rat   309 NELGATNVSPNGLSL------PFSTWDQDHDLRGDLNCAKSLSGGWWFG-TCSHSNLNGQYFHSI 366

  Fly   298 YGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPLK 332
            ..|.....|||.||:: .|....|....:||:|::
  Rat   367 PRQRQQRKKGIFWKTW-KGRYYPLQATTLLIQPME 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 78/227 (34%)
Angptl4NP_954546.1 FReD 182..399 CDD:238040 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.