DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and CG8642

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster


Alignment Length:316 Identity:114/316 - (36%)
Similarity:153/316 - (48%) Gaps:49/316 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ENDTASCPVSTLAGLAA------RVQFMTDELQNLKTELNELQGLIEEY-KNQGTGIPIATRLLR 100
            ||.|..|.....:...|      :::.:..:::..:|.|...|.::.|. |..|:    :..|:.
  Fly   118 ENLTQVCSAQQSSFTTAIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRKLNGS----SALLIE 178

  Fly   101 PLPASVQTFPLALATPPDD-------TPRNC--YDEKHGQVRIRIAPDMEPFFASCDQKVRDG-G 155
            .|...|..|........||       ...:|  :....| :.:...|...||...|:.:...| |
  Fly   179 HLKGKVVYFERKFREKKDDLLADWEAATTSCVPFGRSPG-IHLIHLPGFLPFLVPCEGQTAAGPG 242

  Fly   156 WMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFAL 220
            |..|..|.|||.:|.::|..|..|||.||.||||||:||||||:|:.|||.|.:::..||..:|.
  Fly   243 WTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAH 307

  Fly   221 YDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDD-NGQNCARTHAGAWWYGRE 284
            ||.|.||||.|.|.|.:||.|:|:|.|:||.|...||:|:|:|||. ...|||..|.|||||. .
  Fly   308 YDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYD-F 371

  Fly   285 CFESNLFGTFQSKYGQEIGYFKGIL----------WKSFLPGPTGSLSYVRMLIRP 330
            |..|||.|.          ||||.:          |.||     .||..|:|||||
  Fly   372 CSRSNLNGR----------YFKGEVDNPQSIYWEPWYSF-----RSLKSVQMLIRP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 98/233 (42%)
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 8/44 (18%)
FReD 213..413 CDD:238040 96/217 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D94621at50557
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
87.970

Return to query results.
Submit another query.