DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and CG9500

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:276 Identity:105/276 - (38%)
Similarity:150/276 - (54%) Gaps:23/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FMTDELQNLKTELNELQ----GLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDDTPRN 123
            |..|.....|.||..|.    .|:||  ||...   :|..::...:.:.|..|: ...|...|  
  Fly    26 FQNDTAIRNKPELKSLYKLVLALLEE--NQSNA---STENIQKSSSDLNTTGLS-GRYPSQCP-- 82

  Fly   124 CYDEKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFF 188
            .|...||...:::. .::||..|||.::...||.|:|.|.....:|.:.|..||.|||.|:.:||
  Fly    83 TYPPAHGIYTVQVL-GLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFF 146

  Fly   189 IGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHA 253
            |||||||.:|.|:.|||.|.::...|:.|:|.||...|.||::.|.:..||.:.||||||:.::.
  Fly   147 IGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNR 211

  Fly   254 GKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYF--KGILWKSFLPG 316
            .:.|:|||:|||...:|||..:.||||: ..|..|||||.:..  |.|..||  |||:|.|:   
  Fly   212 NQNFSTFDRDNDGWHKNCAEEYVGAWWH-LNCTYSNLFGIYVK--GDEGQYFQWKGIVWHSW--- 270

  Fly   317 PTGSLSY--VRMLIRP 330
            .|.|.||  ::|::||
  Fly   271 RTESYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 90/216 (42%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 91/220 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D94621at50557
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
98.900

Return to query results.
Submit another query.