DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fibcd1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001101299.1 Gene:Fibcd1 / 311861 RGDID:1309097 Length:459 Species:Rattus norvegicus


Alignment Length:329 Identity:111/329 - (33%)
Similarity:152/329 - (46%) Gaps:47/329 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PFLLAEND--TASCPVSTLAGLAARVQFMTDELQNLKTE-------LNELQGLIEEYKNQGTGIP 93
            |.|||...  .|.|     |||......:...|..|::|       |:|.||.:....|..:.:.
  Rat   143 PRLLARASELQAEC-----AGLRKGHSLLGQGLSTLQSEQGRLIQLLSESQGHMAHLVNSVSDVL 202

  Fly    94 IATR----LLRP-LPASVQTFPLALATP----PDDTPRNCYD-----EKHGQVRIRIAPDMEP-- 142
            .|.:    |.|| :.|.:|..|...|.|    ....||:|.|     ::...| ..:.|...|  
  Rat   203 EALQRERGLGRPRVKADLQRAPSRGARPRGCANGSRPRDCLDVLLSGQQDDGV-YSVFPTHYPAG 266

  Fly   143 FFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLI 207
            |...||.:...|||.|...|.|||.:|.:.|:.|:.|||.|..|.::||.::|.||....:||.:
  Rat   267 FQVYCDMRTDGGGWTVFQRREDGSVNFFRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHV 331

  Fly   208 IMKKKSGEERFALYDHFSIG-----SESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDN 267
            .::.......:|.|..|.:|     .|.:.|.|.| ..|.|.|||||..|:|.:|||.|:|:|.:
  Rat   332 DLEDFDNGTAYAHYGSFGVGLFSVDPEEDGYPLTV-ADYSGTAGDSLLKHSGMRFTTKDRDSDHS 395

  Fly   268 GQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTG---SLSYVRMLIR 329
            ..|||..:.||||| |.|..|||.|  |...|....|..|:.|.|:    ||   ||.:..|.||
  Rat   396 ENNCAAFYRGAWWY-RNCHTSNLNG--QYLRGPHASYADGVEWSSW----TGWQYSLKFSEMKIR 453

  Fly   330 PLKK 333
            ||::
  Rat   454 PLRE 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 83/226 (37%)
Fibcd1NP_001101299.1 FReD 239..455 CDD:238040 83/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.