DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and tnn

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_005171321.1 Gene:tnn / 30234 ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio


Alignment Length:187 Identity:77/187 - (41%)
Similarity:108/187 - (57%) Gaps:12/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 CDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNS-EHHELLIIMK 210
            ||.|...|||:|...|..|..||.|.|::|..|||.|..||::||||:|.|||: ..:|....: 
Zfish   827 CDMKTDGGGWIVFQRRNTGKVDFMKKWRDYMKGFGELTEEFWLGLDKIHELTNTPTQYEARFDL- 890

  Fly   211 KKSGEER-FALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCART 274
             .||.:| :|:||:|.:....:|:.| .:|:|||:|||::.||.|..|:|.|.|||....|||.|
Zfish   891 -GSGSDRKYAVYDNFKVAPSKQKFKL-TIGSYKGNAGDAMTYHQGAPFSTVDSDNDIALGNCALT 953

  Fly   275 HAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPL 331
            |.||||| :.|..:||.|.|...     .:..|:.|:.: .|...||.:..:.|||:
Zfish   954 HQGAWWY-KNCHLANLNGRFGDN-----RHSMGVNWEPW-KGHLQSLDFAEIKIRPV 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 76/185 (41%)
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688
EGF_2 161..189 CDD:285248
EGF_2 193..220 CDD:285248
EGF_2 224..251 CDD:285248
fn3 257..333 CDD:278470
fn3 344..426 CDD:278470
fn3 435..514 CDD:278470
fn3 523..602 CDD:278470
fn3 611..683 CDD:278470
fn3 699..773 CDD:278470
FReD 792..1003 CDD:238040 76/185 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.