DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and tncb

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001299845.1 Gene:tncb / 30037 ZFINID:ZDB-GENE-980526-104 Length:1811 Species:Danio rerio


Alignment Length:326 Identity:104/326 - (31%)
Similarity:152/326 - (46%) Gaps:58/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TLAGLAARVQFMTD-------ELQNLKTEL---------NELQGLIEEYKNQGTGI-------PI 94
            |....|....|.||       ...|::||.         .::.|.|..::: ..|:       |.
Zfish  1483 TAKSAATSTDFTTDVDAPQNLAASNIQTETAMLTWKPPRADISGYILSFES-ADGVVKEVVLSPT 1546

  Fly    95 AT-RLLRPLPASVQ-TFPL-ALATPPDDT---------------PRNCY------DEKHGQVRIR 135
            || ..:..|.||.: |..| |:|.|....               |::|.      |...|...|.
Zfish  1547 ATFYSMSQLTASTEYTVKLQAIAGPKRSRVISTVFLTIGVLYKHPKDCSQALLNGDTTSGLYTIY 1611

  Fly   136 IAPD-MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTN 199
            :..| .:|....||.....|||:|...|..|..:|.::|:||.||||.||.||::||..||::|:
Zfish  1612 LRGDESQPLQVYCDMTTDGGGWIVFVRRQSGKVEFFRNWKNYTAGFGDLNDEFWLGLSNLHKITS 1676

  Fly   200 SEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDN 264
            ...:||.:.::.| ||..:|.||.|||.....:|.::| |.|.|.||||:.||.|:.|:|:|.||
Zfish  1677 FGQYELRVDLRDK-GESAYAQYDKFSISEPRARYKVHV-GGYSGTAGDSMTYHHGRPFSTYDNDN 1739

  Fly   265 DDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIR 329
            |....|||.::.||:|| :.|...|:.|    :||.. .:.||:.|..: .|...|:.:..|.||
Zfish  1740 DIAVTNCALSYKGAFWY-KNCHRVNIMG----RYGDN-SHSKGVNWFHW-KGHEHSVEFAEMKIR 1797

  Fly   330 P 330
            |
Zfish  1798 P 1798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 82/234 (35%)
tncbNP_001299845.1 DnaJ <471..>544 CDD:333066
fn3 689..760 CDD:306538
fn3 778..858 CDD:306538
fn3 868..948 CDD:306538
FN3 958..1047 CDD:238020
fn3 1050..1128 CDD:306538
fn3 1140..1215 CDD:306538
fn3 1231..1303 CDD:306538
fn3 1323..1400 CDD:306538
fn3 1410..1482 CDD:306538
fn3 1498..1570 CDD:306538 15/72 (21%)
FReD 1589..1798 CDD:238040 80/217 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.