DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Angpt4

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001099996.1 Gene:Angpt4 / 296269 RGDID:1307539 Length:508 Species:Rattus norvegicus


Alignment Length:281 Identity:91/281 - (32%)
Similarity:134/281 - (47%) Gaps:27/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TDELQNLKTELNELQGLIEEYKNQGTGI-PIATRLLRPLPASVQTFPLALATPPDDTP--RNCYD 126
            |..|.|||..|..|.......:.|...: .:..||:| :.|..| .|::|.||   .|  |:|.:
  Rat   239 TGALANLKHSLRALSSNSSSLQQQQQQLMELVQRLVR-IVAQDQ-HPVSLKTP---KPLFRDCAE 298

  Fly   127 EKH------GQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNS 185
            .|.      |...|..|...:|....||.:...|||.:|..|.|||.:|.:.|:.||.|||.:..
  Rat   299 IKRSGANTSGVYTIHGANMTKPLKVFCDMETDGGGWTLIQRREDGSLNFQRTWEEYKEGFGNVAR 363

  Fly   186 EFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLR 250
            |.::|.:.:|.||:...:.|.:.:....|.:....|::|.:|||.::|.|.|     .|:..|.|
  Rat   364 EHWLGNEAVHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGSERQRYSLSV-----NDSSISAR 423

  Fly   251 YH-----AGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILW 310
            ..     .|.||:|.|.|||:....||:..:|.||:. .|..|||.|.:...: |.:....||.|
  Rat   424 LKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFD-ACGLSNLNGIYYPVH-QHLHKINGIRW 486

  Fly   311 KSFLPGPTGSLSYVRMLIRPL 331
            ..| .||:.||...||::||:
  Rat   487 HYF-RGPSYSLHGTRMMLRPM 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 73/224 (33%)
Angpt4NP_001099996.1 FReD 291..506 CDD:238040 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.