DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and ANGPTL3

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_055310.1 Gene:ANGPTL3 / 27329 HGNCID:491 Length:460 Species:Homo sapiens


Alignment Length:334 Identity:87/334 - (26%)
Similarity:148/334 - (44%) Gaps:74/334 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LAARVQFMTDELQN----------------LKT---------------------ELNELQGLIEE 84
            |..:|:::.::|.|                |||                     :||:....|:|
Human   134 LQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKE 198

  Fly    85 YKNQGTGIPIATRLLRPLPASVQTFPLALATPP------------DDTPRNC---YDE-KHGQVR 133
            .:||..    .|.:..|...|:.:.|.|..|.|            |..|..|   |:. :|....
Human   199 IENQLR----RTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGM 259

  Fly   134 IRIAP-DMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRL 197
            ..|.| :.:.|...|| .:....|.:|.:|.|||::||:.|:|||.|||.|:.||::||:|::.:
Human   260 YAIRPSNSQVFHVYCD-VISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSI 323

  Fly   198 TNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQ 262
            ....::.|.|.::.....:.:..|. |.:|:....|.|::: |..|:..:::..:....|:|:  
Human   324 VKQSNYVLRIELEDWKDNKHYIEYS-FYLGNHETNYTLHLV-AITGNVPNAIPENKDLVFSTW-- 384

  Fly   263 DNDDNGQ-NCARTHAGAWWYGRECFESNLFGTF-----QSKYGQEIGYFKGILWKSFLPGPTGSL 321
            |:...|. ||...::|.||:..||.|:||.|.:     :||..:.    :|:.||| ..|...|:
Human   385 DHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERR----RGLSWKS-QNGRLYSI 444

  Fly   322 SYVRMLIRP 330
            ...:|||.|
Human   445 KSTKMLIHP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 66/223 (30%)
ANGPTL3NP_055310.1 SMC_N <84..>215 CDD:330553 15/84 (18%)
FReD 243..453 CDD:238040 65/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.