DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Angptl2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_036053.2 Gene:Angptl2 / 26360 MGIID:1347002 Length:493 Species:Mus musculus


Alignment Length:346 Identity:110/346 - (31%)
Similarity:155/346 - (44%) Gaps:83/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KHFSVIMRNSAEPFLLAENDTASCPVSTLAGLAARV-----------------------QFMTDE 67
            :|.:::..|.:|.....|......|       |||.                       |..|:|
Mouse   184 QHLAMLAHNQSEVIAQLEEHCQRVP-------AARPMPQPPPAAPPRVYQPPTYNRIINQISTNE 241

  Fly    68 L---QNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDDTP------RN 123
            :   ||||.                            ||.|:.|.| ||.:.|..|.      |:
Mouse   242 IQSDQNLKV----------------------------LPPSLPTMP-ALTSLPSSTDKPSGPWRD 277

  Fly   124 C---YDEKHGQVRI-RIAPD-----MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAG 179
            |   .::.|....| .:.|:     |:.:   |||:...|||.||..|.|||.:|.::|:.||.|
Mouse   278 CLQALEDGHSTSSIYLVKPENTNRLMQVW---CDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQG 339

  Fly   180 FGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGD 244
            ||.::.|:::||:.::.|||..:::||:.|:..||.:.||.|..|.:..|||.|.|. ||.|.|:
Mouse   340 FGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLR-LGRYHGN 403

  Fly   245 AGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGIL 309
            ||||..:|.||:|||.|:|:|....|||....|.||| ..|..|||.|.:.........|..|:.
Mouse   404 AGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWY-NACAHSNLNGVWYRGGHYRSRYQDGVY 467

  Fly   310 WKSFLPGPTGSLSYVRMLIRP 330
            |..| .|.:.||..|.|:|||
Mouse   468 WAEF-RGGSYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 87/227 (38%)
Angptl2NP_036053.2 t_SNARE 156..>206 CDD:197699 4/21 (19%)
FReD 273..487 CDD:238040 84/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.