DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Tnr

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_037177.2 Gene:Tnr / 25567 RGDID:3886 Length:1358 Species:Rattus norvegicus


Alignment Length:347 Identity:104/347 - (29%)
Similarity:161/347 - (46%) Gaps:55/347 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LPGKHFSVIMRNSAEPFLLAENDTASCPVSTL----AGLAARVQFMTDELQNLKTELNELQGLIE 83
            ||..|::|.|..::.|.:   :.|.:...|||    |.|.|........|.:.:.....::..:.
  Rat  1012 LPRTHYTVTMYATSGPLV---SGTIATNFSTLLDPPANLTASEVTRQSALISWQPPRAAIENYVL 1073

  Fly    84 EYKN------------QGTGIPI------------------ATRLLRPLPASVQTFPLALATPPD 118
            .||:            :.|.|.:                  |||  ..|.:::.|....:.:.|.
  Rat  1074 TYKSTDGSRKELIVDAEDTWIRLEGLSENTDYTVLLQAAQEATR--SSLTSTIFTTGGRVFSHPQ 1136

  Fly   119 DTPRNCY--DEKHGQVRIRIAPDM-EPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGF 180
            |..::..  |...|...|.:..:: ......||.....|||:|...|.:|..||.:.|.:|:.||
  Rat  1137 DCAQHLMNGDTLSGVYTIFLNGELSHKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGF 1201

  Fly   181 GALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEER-FALYDHFSIGSESEKYLLYVLGAYKGD 244
            |.|..||::|||.:||:|....:||.:.|  :.|:|. ||.||.|::......|.|.: |.|.|.
  Rat  1202 GNLEDEFWLGLDNIHRITAQGRYELRVDM--RDGQEAVFAYYDKFAVEDSRSLYKLRI-GGYNGT 1263

  Fly   245 AGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTF-QSKYGQEIGYFKGI 308
            |||||.||.|:.|:|.|:|||....|||.::.||||| :.|..:||.|.: :|::.|.|.::.  
  Rat  1264 AGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWY-KNCHRTNLNGKYGESRHSQGINWYH-- 1325

  Fly   309 LWKSFLPGPTGSLSYVRMLIRP 330
             ||    |...|:.:|.|.:||
  Rat  1326 -WK----GHEFSIPFVEMKMRP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 80/217 (37%)
TnrNP_037177.2 exchanger_TraA <190..>328 CDD:411343
EGF_Tenascin 203..231 CDD:376143
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996 5/13 (38%)
FN3 1042..1127 CDD:238020 12/86 (14%)
FReD 1134..1342 CDD:238040 79/218 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.