DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and ANGPTL5

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_835228.2 Gene:ANGPTL5 / 253935 HGNCID:19705 Length:388 Species:Homo sapiens


Alignment Length:351 Identity:100/351 - (28%)
Similarity:144/351 - (41%) Gaps:76/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NDTA-------SCPVSTLAGLAARVQFMTDELQN------------LKTELNELQGLIEEYKNQ- 88
            |||.       ||.|.|......: .||...|||            |:..::|.|..::...|| 
Human    53 NDTVCKEDCEESCDVKTKITREEK-HFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQV 116

  Fly    89 ----GTGIPIATRLLR----PLP-ASVQTFPLALATPPDDTPRNCYDEKHGQVRIRIAPDMEPFF 144
                ...:.:.|.:.|    |.| ..||:..|. .|...||..:......|...|.......||.
Human   117 NELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLD-CTDIKDTIGSVTKTPSGLYIIHPEGSSYPFE 180

  Fly   145 ASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIM 209
            ..||...|.||..||..|.||..||.:.|.:|..|||.|..||::||.|:..:.|.::...::.:
Human   181 VMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYV 245

  Fly   210 KKKSGEE--RFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKK---------FTTFDQD 263
            ..:|.::  .:|.||:|.:..|:..:.:: ||.|.|:|||:.|   |.|         |:|.|.|
Human   246 ALESEDDTLAYASYDNFWLEDETRFFKMH-LGRYSGNAGDAFR---GLKKEDNQNAMPFSTSDVD 306

  Fly   264 NDD-------NGQ---NCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFK------GILW-- 310
            ||.       |||   :|:..|....|:..||..:||.|         |.:|.      ||.|  
Human   307 NDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNG---------IHHFSGKLLATGIQWGT 362

  Fly   311 --KSFLPGPTGSLSY-VRMLIRPLKK 333
              |:..|....|:|. :|.:..|..|
Human   363 WTKNNSPVKIKSVSMKIRRMYNPYFK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 73/243 (30%)
ANGPTL5NP_835228.2 FReD 146..382 CDD:238040 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.