DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and CG30281

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster


Alignment Length:208 Identity:95/208 - (45%)
Similarity:124/208 - (59%) Gaps:20/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEH 202
            |.:|||...||.::...||.||..|.||||:|.:.|:.|..|||.|:.|||:||:|||.||.:|.
  Fly    84 PGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEP 148

  Fly   203 HELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDN 267
            :||.:.|:..:|....|.|:.|:||:.|..|.|.|||.|.||||||||||.|..|:||  |:||.
  Fly   149 YELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTF--DHDDT 211

  Fly   268 GQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYF------KGILWKSFLPGPTGSLSYVRM 326
            |..|||.:.|||||. :|..|||.|.:     .|.|.|      :||.|.|: .|......:|:|
  Fly   212 GHGCARIYVGAWWYD-QCQRSNLNGQY-----LEGGRFEPKMSGRGITWMSW-RGYDYGYKFVQM 269

  Fly   327 LIRP-----LKKQ 334
            :|||     |::|
  Fly   270 MIRPKCSNNLRRQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 93/203 (46%)
CG30281NP_726164.1 FReD 63..274 CDD:238040 92/198 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D94621at50557
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
98.900

Return to query results.
Submit another query.