DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fgb

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038957639.1 Gene:Fgb / 24366 RGDID:2604 Length:504 Species:Rattus norvegicus


Alignment Length:316 Identity:90/316 - (28%)
Similarity:142/316 - (44%) Gaps:75/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ELQNLKTELNELQGLIEEYK-----NQGTGIPIATRLLR----PLPASVQTFPLALA-------T 115
            ::::.:..:||...::|:.|     .....||:..|:||    .|.:.:|.....::       |
  Rat   149 QVKDNENVINEYSSILEDQKLYIDETVNDNIPLNLRVLRSILEDLRSKIQKLESDISAQTEYCHT 213

  Fly   116 P-------PDDTPRNCYD--EKHGQV--RIRIAPD--MEPFFASCDQKVRDGGWMVIAYRFDGSE 167
            |       |..:.:.|.:  .|.|:.  ...|.||  .:|:...||.|..:|||.||..|.|||.
  Rat   214 PCTVNCNIPVVSGKECEEIIRKGGETSEMYLIQPDTSSKPYRVYCDMKTENGGWTVIQNRQDGSV 278

  Fly   168 DFNKDWQNYKAGFG------------ALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFAL 220
            ||.:.|..||.|||            .|..|:::|.||:.:||.....||||.|:...|::..|.
  Rat   279 DFGRKWDPYKKGFGNIATNEDTKKYCGLPGEYWLGNDKISQLTRIGPTELLIEMEDWKGDKVKAH 343

  Fly   221 YDHFSIGSESEKYLLYVLGAYKGDAGDSL--------------RYHAGKKFTTFDQDND-----D 266
            |..|::.:|:.||.:.| ..|||.||::|              ..|.|..|:|:|:|||     |
  Rat   344 YGGFTVQTEANKYQVSV-NKYKGTAGNALMEGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTD 407

  Fly   267 NGQNCARTHAGAWWYGRECFESN---------LFGTFQSKYGQEIGYFKGILWKSF 313
            ..:.|::...|.|||.| |..:|         |:....||:|.:    .|::|.::
  Rat   408 PRKQCSKEDGGGWWYNR-CHAANPNGRYYWGGLYSWDMSKHGTD----DGVVWMNW 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 76/241 (32%)
FgbXP_038957639.1 Fib_alpha 80..222 CDD:400857 13/72 (18%)
FReD 225..462 CDD:412152 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.