DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and ANGPTL2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens


Alignment Length:335 Identity:106/335 - (31%)
Similarity:159/335 - (47%) Gaps:59/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NDTASCPVSTLAGLAARVQFMTDELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPA---- 104
            |.||.     :..||::.:.:..:.|:|.|..:....:|.:.:.....:|.|..:.:|.||    
Human   164 NQTAD-----MLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARPVPQPPPAAPPR 223

  Fly   105 -----------------------SVQTFPLALATPP--------DDTP----RNC---YDEKHGQ 131
                                   :::..|..|.|.|        .|.|    |:|   .::.|..
Human   224 VYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDT 288

  Fly   132 VRI-RIAPD-----MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIG 190
            ..| .:.|:     |:.:   |||:...|||.||..|.|||.:|.::|:.||.|||.::.|:::|
Human   289 SSIYLVKPENTNRLMQVW---CDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLG 350

  Fly   191 LDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGK 255
            |:.::.|||..:::||:.|:..||.:.||.|..|.:..|||.|.|. ||.|.|:||||..:|.||
Human   351 LENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLR-LGRYHGNAGDSFTWHNGK 414

  Fly   256 KFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGS 320
            :|||.|:|:|....|||....|.||| ..|..|||.|.:.........|..|:.|..| .|.:.|
Human   415 QFTTLDRDHDVYTGNCAHYQKGGWWY-NACAHSNLNGVWYRGGHYRSRYQDGVYWAEF-RGGSYS 477

  Fly   321 LSYVRMLIRP 330
            |..|.|:|||
Human   478 LKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 88/225 (39%)
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 84/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.