DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fgl1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_663569.2 Gene:Fgl1 / 234199 MGIID:102795 Length:314 Species:Mus musculus


Alignment Length:219 Identity:74/219 - (33%)
Similarity:105/219 - (47%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGAL---NSEFF 188
            ::.|..:|:....:..|...||.. ..|||.||..|.||||:||:.|.:|:.|||..   |.|::
Mouse    94 KQSGFYKIKPLQSLAEFSVYCDMS-DGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYW 157

  Fly   189 IGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSL---- 249
            :|...::.||....:.|.|.:........||.|..|.:|.:...|.|.: |.|.|.|||||    
Mouse   158 LGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNI-GEYSGTAGDSLSGTF 221

  Fly   250 -------RYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGT-FQSKYGQEIGYFK 306
                   ..|...||:|:|:|||:...|||......||:.| |..:||.|. ::..|..|..  .
Mouse   222 HPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNR-CHSANLNGVYYRGSYRAETD--N 283

  Fly   307 GILWKSFLPGPTGSLSYVRMLIRP 330
            |::|.:: .|...||..|.|.|||
Mouse   284 GVVWYTW-HGWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 74/219 (34%)
Fgl1NP_663569.2 FReD 80..306 CDD:238040 72/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.