DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and FGG

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:278 Identity:77/278 - (27%)
Similarity:119/278 - (42%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDDTPRNCYD----- 126
            ::.|||.::.:|:...:|                |...:||..        |.|.::|.|     
Human   146 KIVNLKEKVAQLEAQCQE----------------PCKDTVQIH--------DITGKDCQDIANKG 186

  Fly   127 -EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALN----SE 186
             ::.|...|:.....:.|...|:......||.|...|.|||.||.|:|..||.|||.|:    :|
Human   187 AKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTE 251

  Fly   187 FFIGLDKLHRLTNSE--HHELLIIMKKKSGEERFALYDHFSIGSESEKYLL---YVLGAYKGDAG 246
            |::|.:|:|.::...  .:.|.:.::..:|....|.|..|.:|.|::||.|   |..|...|||.
Human   252 FWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAF 316

  Fly   247 DSLRY-----------HAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTF-----Q 295
            |...:           |.|.:|:|:|.|||....|||......||..: |...:|.|.:     .
Human   317 DGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNK-CHAGHLNGVYYQGGTY 380

  Fly   296 SKYGQEIGYFKGILWKSF 313
            ||.....||..||:|.::
Human   381 SKASTPNGYDNGIIWATW 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 68/226 (30%)
FGGNP_068656.2 Fib_alpha 31..172 CDD:285864 8/41 (20%)
FReD 175..414 CDD:294064 68/225 (30%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422
Platelet aggregation and Staphylococcus clumping 423..437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.