DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and FGB

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:379 Identity:99/379 - (26%)
Similarity:162/379 - (42%) Gaps:87/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MRNSAEPFLLAENDTASCPVSTLAGLAARVQFMTDELQNLKTELNELQGLIEEYKNQ-------- 88
            :|||.:..    |:.......|.:.....:..:.|..|..:.::.:.:.::.||.::        
Human   123 IRNSVDEL----NNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYI 183

  Fly    89 ----GTGIPIATRLLRP----LPASVQTFPLALA-------TP-------PDDTPRNCYD--EKH 129
                .:.||...|:||.    |.:.:|.....::       ||       |..:.:.|.:  .|.
Human   184 DETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKG 248

  Fly   130 GQV--RIRIAPD--MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFG--------- 181
            |:.  ...|.||  ::|:...||....:|||.||..|.|||.||.:.|..||.|||         
Human   249 GETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGK 313

  Fly   182 ---ALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKG 243
               .|..|:::|.||:.:||.....||||.|:...|::..|.|..|::.:|:.||.:.| ..|:|
Human   314 NYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISV-NKYRG 377

  Fly   244 DAGDSL--------------RYHAGKKFTTFDQDND-----DNGQNCARTHAGAWWYGRECFESN 289
            .||::|              ..|.|..|:|:|:|||     |..:.|::...|.|||.| |..:|
Human   378 TAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNR-CHAAN 441

  Fly   290 LFGTF---------QSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPLKKQ 334
            ..|.:         .:|:|.:    .|::|.:: .|...|:..:.|.|||...|
Human   442 PNGRYYWGGQYTWDMAKHGTD----DGVVWMNW-KGSWYSMRKMSMKIRPFFPQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 78/257 (30%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 18/114 (16%)
FReD 237..486 CDD:294064 77/255 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.