DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and FCN1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001994.2 Gene:FCN1 / 2219 HGNCID:3623 Length:326 Species:Homo sapiens


Alignment Length:217 Identity:89/217 - (41%)
Similarity:107/217 - (49%) Gaps:13/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PRNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAG 179
            ||||.|      ...|...|.: ||..|....||.....|||.|...|.|||.||.:||..||.|
Human   115 PRNCKDLLDRGYFLSGWHTIYL-PDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQG 178

  Fly   180 FGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAY-KG 243
            ||:...||::|.|.:|.||.....||.:.:....|..:||.|..|.:..|:|||.| ||||: .|
Human   179 FGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKL-VLGAFVGG 242

  Fly   244 DAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGI 308
            .||:||..|....|:|.|||||.:..|||....|||||. :|..|||.|.:  ..|....|..||
Human   243 SAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYA-DCHASNLNGLY--LMGPHESYANGI 304

  Fly   309 LWKSFLPGPTGSLSYVRMLIRP 330
            .| |...|...|.....|.:||
Human   305 NW-SAAKGYKYSYKVSEMKVRP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 89/217 (41%)
FCN1NP_001994.2 Collagen 51..107 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..111
FReD 115..325 CDD:238040 87/215 (40%)
A domain, contributes to trimerization 115..154 12/39 (31%)
B domain, contributes to trimerization 155..243 38/88 (43%)
Carbohydrate-binding. /evidence=ECO:0000269|PubMed:17897951 282..284 0/1 (0%)
P domain. /evidence=ECO:0000303|PubMed:17148457 317..326 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.