DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Tnr

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_071707.2 Gene:Tnr / 21960 MGIID:99516 Length:1358 Species:Mus musculus


Alignment Length:186 Identity:75/186 - (40%)
Similarity:109/186 - (58%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 CDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKK 211
            ||.....|||:|...|.:|..||.:.|.:|:.|||.|..||::|||.:||:|....:||.:.|  
Mouse  1168 CDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGFGNLEDEFWLGLDNIHRITAQGRYELRVDM-- 1230

  Fly   212 KSGEER-FALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTH 275
            :.|:|. ||.||.|::......|.:.: |:|.|.|||||.||.|:.|:|.|:|||....|||.::
Mouse  1231 RDGQEAVFAYYDKFAVEDSRSLYKIRI-GSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSY 1294

  Fly   276 AGAWWYGRECFESNLFGTF-QSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
            .||||| :.|..:||.|.: :|::.|.|.::.   ||    |...|:.:|.|.:||
Mouse  1295 KGAWWY-KNCHRTNLNGKYGESRHSQGINWYH---WK----GHEFSIPFVEMKMRP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 75/186 (40%)
TnrNP_071707.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..58
exchanger_TraA <190..>328 CDD:411343
EGF_Tenascin 203..231 CDD:376143
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996
FN3 1042..1127 CDD:238020
FBG 1134..1343 CDD:214548 75/186 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.