DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and T15B7.1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_504743.3 Gene:T15B7.1 / 188512 WormBaseID:WBGene00020516 Length:372 Species:Caenorhabditis elegans


Alignment Length:181 Identity:53/181 - (29%)
Similarity:84/181 - (46%) Gaps:21/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 CDQKVRDGGWMVIAYRFDGSEDF-NKDWQNYKAGFGAL--NSEFFIGLDKLHRLTNSEHHELLII 208
            ||.:...|||::...|||.||.: ::.|..||.|||.:  ||.|::|.:.||.:|.::...|.:.
 Worm   173 CDMQTYGGGWVLFQNRFDDSESYWDRKWDEYKNGFGDVDENSNFWLGNEALHVMTTNKKVTLRVE 237

  Fly   209 M-------KKKSGEERFALYDHFSIGSESEKY-LLYVLGAYKGDAGDS------LRYHAGKKFTT 259
            |       .|.:.:..|..|..|.:||:::.| ||.:...:....|::      |....|..|:|
 Worm   238 MYGDRTPNSKNATDFWFGHYFDFQVGSKTQNYPLLDLTMDWANPIGNASTAWYDLTCSIGSPFST 302

  Fly   260 FDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILW 310
            .|..:|...:...:...|.||. :.|..|.|.|.:..|.... ||  |:.|
 Worm   303 IDNIHDPVKECVTKFQMGGWWL-KNCALSTLNGAYTPKDWNN-GY--GMFW 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 53/181 (29%)
T15B7.1NP_504743.3 CLECT 21..138 CDD:214480
FReD 144..368 CDD:294064 53/181 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.