DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and B0393.7

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_497983.4 Gene:B0393.7 / 181958 WormBaseID:WBGene00007172 Length:267 Species:Caenorhabditis elegans


Alignment Length:221 Identity:44/221 - (19%)
Similarity:71/221 - (32%) Gaps:54/221 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PDDTPRNCYDEKHGQV-----RIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDF--NKDWQ 174
            |.|....|.|.|...:     ..:.|..|...||.         |::     ||.:|.  ..|..
 Worm    92 PQDMANLCLDRKWQHICAYQGTYKCAKTMNCVFAK---------WLM-----DGKDDCGDGSDED 142

  Fly   175 NYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLG 239
            ....|..:..|........|..:|::|        |.|..:::.||    .:....:      ||
 Worm   143 VCAHGMVSCTSNEPTPTPILDAITSTE--------KPKEPKKKTAL----QVSKRCD------LG 189

  Fly   240 AYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGY 304
            .::...|:.|  ...|.....:...|.:.:|....|.|.......|       :||    :::|.
 Worm   190 EFRCLDGECL--DVSKVLDGQEDCLDSSDENYCEMHDGVCNTAARC-------SFQ----RDVGA 241

  Fly   305 FKGILWKSFLPGPTG--SLSYVRMLI 328
            |.....|.|...|||  .:..:||.:
 Worm   242 FGCGCPKGFARNPTGICEIEEIRMRV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 43/219 (20%)
B0393.7NP_497983.4 LDLa 111..144 CDD:238060 9/46 (20%)
LDLa 186..220 CDD:238060 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.