DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fcnb

DIOPT Version :10

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_006497739.1 Gene:Fcnb / 14134 MGIID:1341158 Length:322 Species:Mus musculus


Alignment Length:225 Identity:74/225 - (32%)
Similarity:93/225 - (41%) Gaps:46/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PRNCYD---EKH---GQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAG 179
            ||.|.:   :.|   |...|.: ||..|....||.....|||.|...|.|||.||.:||.:||.|
Mouse   103 PRTCKELLTQGHFLTGWYTIYL-PDCRPLTVLCDMDTDGGGWTVFQRRLDGSVDFFRDWTSYKRG 166

  Fly   180 FGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGD 244
            ||:...||::|.|.:|.||.....||.:.:....|:..||.|..|.|..|:|||.| :||.:.|.
Mouse   167 FGSQLGEFWLGNDNIHALTTQGTSELRVDLSDFEGKHDFAKYSSFQIQGEAEKYKL-ILGNFLGG 230

  Fly   245 AGDSLRYHAGKKF--TTFDQD----NDDNGQNCARTHAGAWWYGRECFES------NLF-GTFQS 296
            .       ||..|  .|..|:    |....|.....|...    ::|..|      |.| |.|.|
Mouse   231 G-------AGPAFPSVTISQNLSVTNPLRSQISQSNHLTL----KQCLPSTKPSTYNTFRGCFIS 284

  Fly   297 KYGQEIGYFKGILWKSFLPGPT---GSLSY 323
            |..|.:           .|..|   ||.||
Mouse   285 KPQQHV-----------FPRRTCGLGSASY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 74/225 (33%)
FcnbXP_006497739.1 Collagen 40..95 CDD:460189
FReD 103..>238 CDD:238040 54/143 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.