DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Angpt4

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_033771.1 Gene:Angpt4 / 11602 MGIID:1336887 Length:509 Species:Mus musculus


Alignment Length:278 Identity:89/278 - (32%)
Similarity:137/278 - (49%) Gaps:21/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TDELQNLKTELNEL---QGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDDTP--RNC 124
            |..|.|||..|:.|   ...:::.:.|.|  ....||:| :.|..| .|::|.||   .|  ::|
Mouse   240 TGTLANLKHNLHALSSNSSSLQQQQQQLT--EFVQRLVR-IVAQDQ-HPVSLKTP---KPVFQDC 297

  Fly   125 YDEKH------GQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGAL 183
            .:.|.      |...|......:|....||.:...|||.:|.:|.|||.:|.:.|:.||.|||.:
Mouse   298 AEIKRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQHREDGSVNFQRTWEEYKEGFGNV 362

  Fly   184 NSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDS 248
            ..|.::|.:.:||||:...:.|.:.:....|.:....|::|.:|||.::|.|.|..:.......:
Mouse   363 AREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQYENFQLGSERQRYSLSVNDSSSSAGRKN 427

  Fly   249 LRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSF 313
            .....|.||:|.|.|||:....||:..:|.||:. .|..|||.|.:.|.: |.:....||.|..|
Mouse   428 SLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFD-ACGLSNLNGIYYSVH-QHLHKINGIRWHYF 490

  Fly   314 LPGPTGSLSYVRMLIRPL 331
             .||:.||...||::||:
Mouse   491 -RGPSYSLHGTRMMLRPM 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 70/219 (32%)
Angpt4NP_033771.1 BMFP 140..217 CDD:294701
FReD 292..507 CDD:238040 70/217 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..436 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.