DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Angpt2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_031452.2 Gene:Angpt2 / 11601 MGIID:1202890 Length:496 Species:Mus musculus


Alignment Length:295 Identity:87/295 - (29%)
Similarity:130/295 - (44%) Gaps:33/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TDELQNLKTELNELQGLIEE----------------------YKNQGTGIPIATRLLRPLPASVQ 107
            :::||::|.:.:|||.|:.:                      .|.|...:.....||..:.:...
Mouse   203 SEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNS 267

  Fly   108 TFPLALATPPDDTPRNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGS 166
            ...:|:......|.|:|.:      ...|...:......|...|.||..|..|||.||.:|.|||
Mouse   268 KSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGS 332

  Fly   167 EDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESE 231
            .||.:.|:.||.|||:...|:::|.:.:.:||....:.|.|.:|...|.|..:|||||.:..|..
Mouse   333 VDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEES 397

  Fly   232 KYLLYVLGAYKGDAGD-SLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQ 295
            .|.:::.| ..|.||. |.....|..|:|.|.|||.....|::..:|.||:. .|..|||.|.:.
Mouse   398 NYRIHLTG-LTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFD-ACGPSNLNGQYY 460

  Fly   296 SKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
            .: .|....|.||.| .:..|...||....|:|||
Mouse   461 PQ-KQNTNKFNGIKW-YYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 75/219 (34%)
Angpt2NP_031452.2 RILP-like <168..226 CDD:304877 7/22 (32%)
FBG 280..494 CDD:214548 75/218 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.