DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Angpt1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_033770.2 Gene:Angpt1 / 11600 MGIID:108448 Length:498 Species:Mus musculus


Alignment Length:296 Identity:101/296 - (34%)
Similarity:139/296 - (46%) Gaps:36/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DELQNLKTELNELQGL-------IEEYKNQGTGIPIATRLLR----PLPASVQTFPLALATP--- 116
            :||..||.|...||||       |:|.:.|.:.......:|:    .|..:|... ::|.|.   
Mouse   207 EELDTLKEEKENLQGLVSRQTFIIQELEKQLSRATNNNSILQKQQLELMDTVHNL-ISLCTKEGV 270

  Fly   117 -------PDDTP-RNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSE 167
                   .::.| |:|.|      .|.|...|......||....|:..|..|||.||.:|.|||.
Mouse   271 LLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSL 335

  Fly   168 DFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEK 232
            ||.:.|:.||.|||..:.|:::|.:.:..:|:...:.|.|.:....|...::.||.|.||:|.:.
Mouse   336 DFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQN 400

  Fly   233 YLLYVLGAYKGDAG--DSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQ 295
            |.||:.| :.|.||  .||..| |..|:|.|.|||:....||....|.||:. .|..|||.|.|.
Mouse   401 YRLYLKG-HTGTAGKQSSLILH-GADFSTKDADNDNCMCKCALMLTGGWWFD-ACGPSNLNGMFY 462

  Fly   296 SKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPL 331
            :. ||..|...||.|..| .||:.||....|:||||
Mouse   463 TA-GQNHGKLNGIKWHYF-KGPSYSLRSTTMMIRPL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 82/220 (37%)
Angpt1NP_033770.2 RILP-like <133..238 CDD:304877 12/30 (40%)
FReD 281..496 CDD:238040 82/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.