DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl3

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_571893.2 Gene:angptl3 / 114421 ZFINID:ZDB-GENE-010817-3 Length:466 Species:Danio rerio


Alignment Length:317 Identity:92/317 - (29%)
Similarity:144/317 - (45%) Gaps:48/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLAENDTASCPVSTLAGLAARVQFMTDELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPA 104
            :.|..|.......|:..|...|:...|:|...|.::..|:..:.....|.|       :.:|:..
Zfish   167 ITALKDVIETQERTITDLLRSVKEQHDQLNYQKIKIKSLEDKVNYDTFQDT-------IEKPMDL 224

  Fly   105 SVQTFPLALATPPD-----------------DTPRNCYDE-KHGQVRIRIAP----DMEPFFASC 147
            :.:|        ||                 |.|.:|.:. ..||....|.|    ..|||:..|
Zfish   225 NPET--------PDPFRYLTTNSTNGTKDINDFPADCSEVFTRGQKTSGIYPIKPNQSEPFYVYC 281

  Fly   148 DQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKK 212
             :...||...||..|.|||.||::.|:.|:.|||.|..||::||.|:|.:.....:.|.|.::..
Zfish   282 -EITPDGAATVIQRREDGSVDFDQSWEKYEHGFGKLEKEFWLGLAKIHSIAQQGEYILHIELEDW 345

  Fly   213 SGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQ-NCARTHA 276
            ..|:||..|. |::...:..|.|: |....||..|::..|.|.||:|.|:|||::.: ||||.:.
Zfish   346 KEEKRFIEYT-FTLEGPASDYALH-LAPLSGDLSDAMSNHTGMKFSTKDRDNDNHDESNCARNYT 408

  Fly   277 GAWWYGRECFESNLFGTF---QSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
            |.||:. .|.::||.|.:   :||...:  ..|||.|:. ..|.:.:|...::.|||
Zfish   409 GGWWFD-ACGDTNLNGRYAWMRSKARHQ--RRKGIYWRP-SKGSSYTLKSTKITIRP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 77/221 (35%)
angptl3NP_571893.2 SMC_N <111..>209 CDD:330553 9/41 (22%)
FReD 248..461 CDD:238040 75/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.