DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angpt2b

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_571889.1 Gene:angpt2b / 114408 ZFINID:ZDB-GENE-010817-2 Length:489 Species:Danio rerio


Alignment Length:350 Identity:110/350 - (31%)
Similarity:160/350 - (45%) Gaps:44/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NATSNLPGK--HFSVIMRNSAEPFLLAE-------NDTASCPVSTLAGLAAR-------VQFMTD 66
            |.||.|..:  .:| :..|..|..||.:       ||..|......|.:.|:       :|....
Zfish   146 NQTSRLEIQLLEYS-LSTNRLEKQLLEQTQEVSRLNDKNSYMEQRFADMEAKHSRELQAIQQEKQ 209

  Fly    67 ELQNLKTELNELQGLIE-EYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDD--TP------- 121
            :|..|....|||..|:| |..:......:..|....|..:||.. ||:.|..:|  ||       
Zfish   210 QLLELLDRQNELVSLLEGELASSTRNSTLIQRQQASLTDTVQQL-LAMVTHCNDISTPVDKEMLK 273

  Fly   122 -RNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAG 179
             |:|.:      .::|...|.:....:.....||.|.:.|||.|..:|:|||.|||:||.:||.|
Zfish   274 FRDCAEIFKSGVTENGIYSIHLPNSTQKIKVFCDMKTKGGGWTVFQHRYDGSVDFNRDWNDYKLG 338

  Fly   180 FGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGD 244
            ||..:.|.::|.|.:|.||.::.:.|.:.:|.....:.::.||.|.|..|.:||.|:..| :.|.
Zfish   339 FGDPSGEHWLGNDVIHLLTTTKDYTLQVHLKDAEEHQAYSQYDTFYIDGEDKKYSLHARG-FSGT 402

  Fly   245 AG-DSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGY--FK 306
            || .|...|:|.:|:|.|||||.....||:...|.||: ..|..|||.|.:.|.....|.|  .|
Zfish   403 AGRTSSLTHSGTQFSTKDQDNDQCSCKCAQMATGGWWF-EACGPSNLNGIYYSGNSNVIRYNSIK 466

  Fly   307 GILWKSFLPGPTGSLSYVRMLIRPL 331
            ...||    ||:...:...|:|||:
Zfish   467 WYYWK----GPSWMATMTTMMIRPV 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 79/230 (34%)
angpt2bNP_571889.1 NYD-SP28 164..244 CDD:291438 18/79 (23%)
FReD 274..487 CDD:238040 76/218 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.