DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fcnb

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:177 Identity:75/177 - (42%)
Similarity:94/177 - (53%) Gaps:5/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEH 202
            ||..|....||.....|||.|...|.||:.||.:||.:||.|||:...||::|.|.:|.||....
  Rat   130 PDCRPLTVLCDMDTDGGGWTVFQRRIDGTVDFFRDWTSYKQGFGSQLGEFWLGNDNIHALTTQGT 194

  Fly   203 HELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAY-KGDAGDSLRYHAGKKFTTFDQDNDD 266
            :||.:.:....|...||.|..|.|..|:|||.| :||.: .|.|||||.......|:|.|||||.
  Rat   195 NELRVDLADFDGNHDFAKYSSFQIQGEAEKYKL-ILGNFLGGGAGDSLTSQNNMLFSTKDQDNDQ 258

  Fly   267 NGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSF 313
            ...|||..:.|||||. :|..|||.|.:..  |....|..|:.|||:
  Rat   259 GSSNCAVRYHGAWWYS-DCHTSNLNGLYLR--GLHKSYANGVNWKSW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 75/177 (42%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106
FReD 108..317 CDD:238040 75/177 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.