DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fgb

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_862897.1 Gene:Fgb / 110135 MGIID:99501 Length:481 Species:Mus musculus


Alignment Length:395 Identity:108/395 - (27%)
Similarity:171/395 - (43%) Gaps:86/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CLSTTTNATSNLPGKHFSVIMRNSAEPFLLAENDTASCP---VSTLAGLAARVQFMTDELQNLKT 73
            |....|......|.|.....:.|:.:    :.:||:|..   ::.|..:..:.|....|.:|:  
Mouse   100 CTLQQTLLNQERPIKSSIAELNNNIQ----SVSDTSSVTFQYLTLLKDMWKKKQAQVKENENV-- 158

  Fly    74 ELNELQGLIEEYK-----NQGTGIPIATRLLR----PLPASVQTFPLALA-------TP------ 116
             :||...::|:.:     .....||:..|:||    .|.:.:|.....::       ||      
Mouse   159 -INEYSSILEDQRLYIDETVNDNIPLNLRVLRSILEDLRSKIQKLESDISAQMEYCRTPCTVSCN 222

  Fly   117 -PDDTPRNCYD--EKHGQV--RIRIAPD--MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQ 174
             |..:.:.|.:  .|.|:.  ...|.||  ::|:...||.|..:|||.||..|.|||.||.:.|.
Mouse   223 IPVVSGKECEEIIRKGGETSEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWD 287

  Fly   175 NYKAGFG------------ALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIG 227
            .||.|||            .|..|:::|.||:.:||.....||||.|:...|::..|.|..|::.
Mouse   288 PYKKGFGNIATNEDAKKYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQ 352

  Fly   228 SESEKYLLYVLGAYKGDAGDSL--------------RYHAGKKFTTFDQDND-----DNGQNCAR 273
            :|:.||.:.| ..|||.||::|              ..|.|..|:|:|:|||     |..:.|::
Mouse   353 NEASKYQVSV-NKYKGTAGNALMDGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSK 416

  Fly   274 THAGAWWYGRECFESN---------LFGTFQSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIR 329
            ...|.|||.| |..:|         |:....||:|.:    .|::|.:: .|...|:..:.|.||
Mouse   417 EDGGGWWYNR-CHAANPNGRYYWGGLYSWDMSKHGTD----DGVVWMNW-KGSWYSMRRMSMKIR 475

  Fly   330 PLKKQ 334
            |...|
Mouse   476 PFFPQ 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 81/257 (32%)
FgbNP_862897.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..81
Beta-chain polymerization, binding distal domain of another fibrin. /evidence=ECO:0000250 35..37
Fib_alpha 82..224 CDD:285864 24/130 (18%)
FReD 227..476 CDD:294064 80/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.