DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and FGL2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_006673.1 Gene:FGL2 / 10875 HGNCID:3696 Length:439 Species:Homo sapiens


Alignment Length:371 Identity:117/371 - (31%)
Similarity:176/371 - (47%) Gaps:64/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEALVTAL--ACLSTTTNATSN-LPGKHFSVIMRNSAEPFLLAENDTASCPVSTLAGLAARVQFM 64
            |:.:|.:|  :|......|..| .||:: .:::.::..|..:.:|        .:..|.:.|..:
Human    85 LKEIVNSLKKSCQDCKLQADDNGDPGRN-GLLLPSTGAPGEVGDN--------RVRELESEVNKL 140

  Fly    65 TDELQNLKTELNELQGLIEEYK------------NQGTGIPIATRLLR------PLPASVQTFPL 111
            :.||:|.|.|:|.|.|.:|:..            ::...:......|.      |....:|:.|:
Human   141 SSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPV 205

  Fly   112 ALATPPDDTPRNCYD----EKHGQVRIRIAPDME--PFFASCDQKVRDGGWMVIAYRFDGSEDFN 170
            ......|     |.|    .|......|:.||.:  .|...||.:...|||.|:..|.|||.:|.
Human   206 QHLIYKD-----CSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFT 265

  Fly   171 KDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLL 235
            :.||:||||||.|..||::|.||:|.||.|:...|.|.::..:|.|.:||||.|.:.:|..||.|
Human   266 RTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRL 330

  Fly   236 YVLGAYKGDAGDSLRY-----HAGKKFTTFDQDND--DNGQNCARTHAGAWWYGRECFESNLFGT 293
            :| |.|.|.|||:||:     |..|.|||.|:|||  .:| ||...::..||:. .|..:||.|.
Human   331 HV-GNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSG-NCGLYYSSGWWFD-ACLSANLNGK 392

  Fly   294 FQSKYGQEI-GYFKGILWKSFLPG-----PTG---SLSYVRMLIRP 330
            :   |.|:. |...||.|.:: ||     |.|   |....:|:|||
Human   393 Y---YHQKYRGVRNGIFWGTW-PGVSEAHPGGYKSSFKEAKMMIRP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 91/234 (39%)
FGL2NP_006673.1 DUF460 <28..>161 CDD:331991 21/84 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..126 5/23 (22%)
FReD 209..435 CDD:294064 92/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.