DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and LOC108179162

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_017211437.2 Gene:LOC108179162 / 108179162 -ID:- Length:243 Species:Danio rerio


Alignment Length:195 Identity:70/195 - (35%)
Similarity:109/195 - (55%) Gaps:11/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PFFASCDQKVRD------GGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNS 200
            |.:..| |.:.|      |||.|...|.||..:|.:.|:.||.|||....|:::||:.|::||..
Zfish    50 PVWVYC-QMISDGKDEENGGWTVFQRRMDGRINFYQPWEEYKRGFGTTEGEYWLGLENLYQLTRH 113

  Fly   201 EHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDND 265
            :...|.:.::...|...||.|..||:|||:|.|.|.|.|...|.|||||..|..:||:|||:|.|
Zfish   114 KKFMLRVDLEDFEGRRGFAQYSSFSVGSEAEGYRLQVSGFTDGGAGDSLTDHNDQKFSTFDKDQD 178

  Fly   266 DNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFK-GILWKSFLPGPTGSLSYVRMLIR 329
            ..|.|||:...||:|: :.|..:|..|.:  .:|::..:|. |::|.::....|.|:..:.::|:
Zfish   179 AYGDNCAQEFLGAFWF-KYCHNTNPNGVY--LWGEDDTHFGIGVVWSTWKDSFTVSMKSLSLMIK 240

  Fly   330  329
            Zfish   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 70/195 (36%)
LOC108179162XP_017211437.2 FReD 24..242 CDD:238040 70/195 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.