DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and si:zfos-2330d3.6

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_009294456.1 Gene:si:zfos-2330d3.6 / 103909555 ZFINID:ZDB-GENE-110411-23 Length:242 Species:Danio rerio


Alignment Length:180 Identity:71/180 - (39%)
Similarity:109/180 - (60%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEER 217
            :|||.|...|.|||.:|.:.|:.||.|||.:..|:::||:.|::||..:...|.:.::...|.:.
Zfish    65 NGGWTVFQRRMDGSVNFFRPWEEYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRKG 129

  Fly   218 FALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYG 282
            ||.|..||:|||:|.|.|.|.|...|.|||||.||:|.||||:|:|.|.:.|||||.:.||:|| 
Zfish   130 FAQYSSFSVGSEAEGYKLQVSGFTNGGAGDSLIYHSGMKFTTYDKDQDTHTQNCARIYVGAFWY- 193

  Fly   283 RECFESNLFGTFQSKYGQEIGYFK-GILWKSFLPGPTGSLSYVRMLIRPL 331
            ::|..:|..|.:..  |::...|. |.:|.::.......:.::.|.|:|:
Zfish   194 KDCHNANPNGVYLG--GEDKTLFAIGNVWYTWKNNFEIGMKFITMKIKPV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 70/178 (39%)
si:zfos-2330d3.6XP_009294456.1 FReD 23..241 CDD:238040 70/178 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.