DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and ANGPTL7

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens


Alignment Length:346 Identity:100/346 - (28%)
Similarity:148/346 - (42%) Gaps:76/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KHFSVIMRNSAEPFLLAENDTASC-PVSTLAGLAARVQFMTDEL--------------------- 68
            ||     :..|:|.|.|.|   .| .|..|....|.:..:..||                     
Human    31 KH-----KTPAQPQLKAAN---CCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESN 87

  Fly    69 -QNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLAL-----------------AT 115
             :.:::.|.:.:....|..||     |....|:......||...|:                 ..
Human    88 SKRMESRLTDAESKYSEMNNQ-----IDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKL 147

  Fly   116 PPDDTPRNCYDEKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGF 180
            ||||              ...:|::|.|   ||.:...|||.:|..|..|...|.:||:.||.||
Human   148 PPDD--------------FLGSPELEVF---CDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGF 195

  Fly   181 GALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDA 245
            |::..:|::|.:.:|||:. :...|.:.|:...|..|:|.|.||.:|:|...|.|: ||.|.|:.
Human   196 GSIRGDFWLGNEHIHRLSR-QPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLF-LGNYTGNV 258

  Fly   246 G-DSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGIL 309
            | |:|:||....|:|.|:|||:....||:...|.:||.. |.:|||.|.:. :.|:...:..||.
Human   259 GNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNC-CTDSNLNGVYY-RLGEHNKHLDGIT 321

  Fly   310 WKSFLPGPTGSLSYVRMLIRP 330
            |..: .|.|.||..|.|.|||
Human   322 WYGW-HGSTYSLKRVEMKIRP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 75/213 (35%)
ANGPTL7NP_066969.1 SMC_N <37..>109 CDD:330553 14/79 (18%)
FReD 129..341 CDD:238040 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.