DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and fcn2l

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_004917606.2 Gene:fcn2l / 101735093 XenbaseID:XB-GENE-22167163 Length:301 Species:Xenopus tropicalis


Alignment Length:217 Identity:85/217 - (39%)
Similarity:120/217 - (55%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RNCYD-EKHGQVR---IRIAPD-MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFG 181
            |||.: ...|:|.   ..|.|| ::|....||.....|||:|...|:|||.||.:||::||:|||
 Frog    91 RNCKELLDQGEVLSDWYIIYPDGVQPMKVLCDMHTDGGGWIVFQRRWDGSVDFFRDWKSYKSGFG 155

  Fly   182 ALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYK-GDA 245
            :..:||::|.|.||:||:|...||.:.::.....:.||.|:.|.|..||||:.| ::||.| |:.
 Frog   156 SRLNEFWLGNDNLHKLTSSGTWELRVDLQDFENAKHFAKYESFRILGESEKFKL-LIGAMKGGNI 219

  Fly   246 GDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILW 310
            .|:::.|....|:|.|||||...::||..:.|.||| ..|..|||.|.:  ..|......:||.|
 Frog   220 EDAMKVHNTMPFSTKDQDNDILPEHCADRYKGGWWY-NGCHHSNLNGLY--LLGSHSNTAEGINW 281

  Fly   311 KSFLPGPTGSLSYVR--MLIRP 330
            ..   |...:.||.|  |.|||
 Frog   282 YG---GRGHNYSYKRSEMKIRP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 85/217 (39%)
fcn2lXP_004917606.2 Collagen 38..>79 CDD:396114
FReD 91..300 CDD:238040 83/215 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.