DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and tnxba

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_021322558.1 Gene:tnxba / 100536295 ZFINID:ZDB-GENE-070103-5 Length:2285 Species:Danio rerio


Alignment Length:224 Identity:81/224 - (36%)
Similarity:122/224 - (54%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PDDTPRNCYD------EKHGQVRIRIAPD---MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKD 172
            |...|.:|.:      ::.|:.  .|.|:   .||....||.:...|.|.|...|.|||.||.:.
Zfish  2059 PHPYPTDCSEVQINGMKESGEA--EIYPEGKNGEPVRVYCDMETDGGAWTVFQRRMDGSTDFFRS 2121

  Fly   173 WQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEE-RFALYDHFSIGSESEKYLLY 236
            |::|..|||.|:.||::|.|.||.||:.:...|.|.:  :||.: .||.|.:|:|.||:..|.:.
Zfish  2122 WRDYSKGFGLLSGEFWLGNDVLHTLTSLKAMSLRIDL--RSGNDTAFAQYINFNISSEANHYAID 2184

  Fly   237 VLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQE 301
            :.| |.|.||||::||.|:.|:|.|:|.|....:||:.:.|.||| :.|:::||.|.:.| |...
Zfish  2185 LSG-YSGTAGDSMKYHKGRPFSTKDKDPDTLSIHCAKAYMGGWWY-KNCYKANLNGLYAS-YSDN 2246

  Fly   302 IGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
                ||::|..: .|...||.:..|.:||
Zfish  2247 ----KGVVWIDW-KGKDASLPFTEMKLRP 2270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 80/222 (36%)
tnxbaXP_021322558.1 COG3942 596..>913 CDD:332523
EGF_2 1380..1406 CDD:285248
fn3 1792..1870 CDD:306538
fn3 1880..1952 CDD:306538
fn3 1976..2037 CDD:306538
FReD 2061..2270 CDD:238040 78/220 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.