DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and LOC100496945

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_002935082.1 Gene:LOC100496945 / 100496945 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:226 Identity:91/226 - (40%)
Similarity:120/226 - (53%) Gaps:23/226 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PDD--TPRNCYDEKHGQVRI-----RIAPDME-PFFASCDQKVRDGGWMVIAYRFDGSEDFNKDW 173
            ||.  ..||| .|...|..|     :|.||.| |....||.....|||:|....:|||.||.:||
 Frog    91 PDQLYAARNC-KELLDQGAILSGWYKIYPDGERPLTVLCDMDTDGGGWIVFQRTWDGSVDFFRDW 154

  Fly   174 QNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVL 238
            .:||.|||:..|||::|.|.:|.||:|..::|.|.......:..||.||.|:...|.:.|.| :|
 Frog   155 DSYKKGFGSQLSEFWLGNDNIHTLTSSGTYQLRIDFTDFENQNSFAAYDSFATLGEKDHYQL-IL 218

  Fly   239 GAYK-GDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTF-QSKYGQE 301
            |||. |.|||||.:|....|:|  :|||.:|.|||.|..|.|||| .|.::||.|.: :.|:..:
 Frog   219 GAYSGGTAGDSLNHHRNCPFST--KDNDLHGNNCAETFKGGWWYG-SCHDANLNGLYLRGKHSND 280

  Fly   302 IGYFKGILWKSFLPGPTGSLSY--VRMLIRP 330
             |.  ||.|::   |...:.||  ..|..||
 Frog   281 -GL--GINWET---GKGNNYSYKVTEMKFRP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 89/224 (40%)
LOC100496945XP_002935082.1 Collagen 41..91 CDD:189968 91/226 (40%)
FReD 98..306 CDD:238040 89/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.