DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and fgl2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_002933134.2 Gene:fgl2 / 100494596 XenbaseID:XB-GENE-482375 Length:429 Species:Xenopus tropicalis


Alignment Length:386 Identity:113/386 - (29%)
Similarity:167/386 - (43%) Gaps:89/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEALVTALACLSTTTNATSNLPGKHFSVIMRNSAEPFLLAENDT------ASCPVST-------L 54
            ||..:..:..|....||            ::.|.:...|..:||      ...|.||       :
 Frog    70 LEKTIKEVQSLKEIVNA------------LKKSCQDCKLQADDTPEKDNGQQNPESTNGDQDNNI 122

  Fly    55 AGLAARVQFMTDELQNLKTELNELQ-----------GLIEEYKNQGTGIPIATRLLRPLPASVQT 108
            ..|.::|:.|:..|:|.:.::|.||           ..||:|        :.|:::. |..::..
 Frog   123 HELQSKVKKMSISLKNARNQINSLQEQLGKMSPINMNTIEQY--------VDTKMIN-LSFALNN 178

  Fly   109 F--------PLALATPPDD-TPRNCYD----EKHGQVRIRIAPD--MEPFFASCDQKVRDGGWMV 158
            .        |:..|.|... ..::|.|    .|....|.|:.||  .:.|...||.:...|||.|
 Frog   179 LDNKCSSNCPVLEANPSIQLLYKDCSDYYKIGKKVDGRYRVTPDEKNKTFEVYCDMESMGGGWTV 243

  Fly   159 IAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDH 223
            :..|.|||..||:.|..||.|||.|..||::|.||||.||.|....|.|.::...|...:|.||.
 Frog   244 VQIRKDGSTSFNRTWNEYKNGFGNLTGEFWLGNDKLHLLTKSTDMILRIELEDFKGNREYAKYDQ 308

  Fly   224 FSIGSESEKYLLYVLGAYKGDAGDSLRY-----HAGKKFTTFDQDND--DNGQNCARTHAGAWWY 281
            |.:.:|..||.| .:|.|.|.|||:|.:     |..|.|||.|:|||  .:| ||...::..||:
 Frog   309 FYVANEYLKYRL-TIGGYSGTAGDALHFSKQYNHDQKFFTTPDKDNDRYPSG-NCGSYYSSGWWF 371

  Fly   282 GRECFESNLFGTFQSKYGQEI-GYFKGILWKSFLPGPTG-----------SLSYVRMLIRP 330
            . .|..:||.|.:   |..:. |...||.|.::    ||           :..:|:|:|||
 Frog   372 D-ACMSANLNGKY---YKNDYKGVRNGIFWGTW----TGVSDEHLNSYRQTFKFVKMMIRP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 85/238 (36%)
fgl2XP_002933134.2 Smc <53..164 CDD:224117 22/105 (21%)
FReD 199..425 CDD:238040 85/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.