DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and LOC100493748

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_002945140.2 Gene:LOC100493748 / 100493748 -ID:- Length:227 Species:Xenopus tropicalis


Alignment Length:216 Identity:80/216 - (37%)
Similarity:109/216 - (50%) Gaps:13/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RNCYDEKHGQVRI----RIAPD-MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFG 181
            |||.:..|..|.:    .|.|| |.|....||.....|||:|...|:|||.||...|.:||.|||
 Frog    19 RNCKELLHQGVVMSGWYTIYPDGMAPLQVLCDMDTDGGGWIVFQRRYDGSVDFYLGWDSYKRGFG 83

  Fly   182 ALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAY-KGDA 245
            :..:||::|.|.|...|:|...|:.:.::.....:.:|.|..|.:..||:.|.| ::|.| .|||
 Frog    84 SRLTEFWLGNDNLSNFTSSGTWEMRVDLRDFDNIQHYAKYSSFRVLPESDSYTL-IIGPYVAGDA 147

  Fly   246 GDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILW 310
            |||:.|....||||.|:|||.....||....||||| :.|:.:||.|.:.......|   ..|.|
 Frog   148 GDSMSYSNYSKFTTKDRDNDMYEGKCADIDRGAWWY-KICYNANLNGFYHLAQNYNI---DSICW 208

  Fly   311 KSFLPGPTGSLSYVRMLIRPL 331
            .|.  |...|..:..|.:||:
 Frog   209 LSL--GSYYSFKFTEMKMRPV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 79/214 (37%)
LOC100493748XP_002945140.2 FReD 19..227 CDD:238040 79/214 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.