DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and mfap4.2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_012826893.1 Gene:mfap4.2 / 100488329 XenbaseID:XB-GENE-22167947 Length:261 Species:Xenopus tropicalis


Alignment Length:223 Identity:74/223 - (33%)
Similarity:105/223 - (47%) Gaps:20/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PRNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAG 179
            |.:|.|      ::.|...|..|.........||....:..|.||..|||||..|::.|.:||.|
 Frog    34 PADCEDVYALGSKEDGVYIIYPAGSSSALPVYCDMTTDEAKWTVIQKRFDGSLSFSRGWTDYKLG 98

  Fly   180 FGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFS-----IGSESEKYLLYVLG 239
            ||..:.|:::||..:::||..:.:.|.|.:.........|.|..||     |..|.:.|.|:|.|
 Frog    99 FGRADEEYWLGLHNIYQLTLQKKYMLRIELGDFENNTAHAEYTDFSLSPNAINPEDDGYTLFVDG 163

  Fly   240 AYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGY 304
            ...|.|||||.:|.|.||:|||.|.|...||||..::..:|: :.|..:|:.|    .|.|:..|
 Frog   164 FIDGGAGDSLTFHNGMKFSTFDHDQDTYQQNCAFLYSSGFWF-KGCHLANING----PYLQDATY 223

  Fly   305 F---KGILWKSFLPGPTGSLSYVRMLIR 329
            .   .||.|..: .|...||....:.||
 Frog   224 TSSGNGITWTRW-KGFNYSLKTTEIKIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 74/223 (33%)
mfap4.2XP_012826893.1 FReD 32..252 CDD:238040 74/223 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.