DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and XB5913531

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_012826224.3 Gene:XB5913531 / 100488177 XenbaseID:XB-GENE-5913532 Length:255 Species:Xenopus tropicalis


Alignment Length:251 Identity:79/251 - (31%)
Similarity:122/251 - (48%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PLALATP------PDDT-------PRNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGG 155
            ||:|.:|      ..||       |.:|.|      ...|:..|.......|....||.......
 Frog    11 PLSLISPIISQSESLDTLVLHKIPPLDCQDLWDKGFRSDGEYLIYPQGPQHPLPVYCDMTTNGMP 75

  Fly   156 WMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFAL 220
            |.|...|||||.|||::||:|..|||..:.|:::||..:.|||.:..:||.:.::..:|::.:|.
 Frog    76 WTVFQKRFDGSTDFNQNWQDYVMGFGNADYEYWLGLQNIQRLTMTGRYELRVELENFNGQKVYAF 140

  Fly   221 YDHFS-----IGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGA-W 279
            |.:||     :.:|.:.|.|||.|...|.|||||..|.|::|:|:|.|..::.||||....|. |
 Frog   141 YSNFSLSPQALNAEHDGYKLYVDGFTDGGAGDSLSVHVGQRFSTYDNDQINDIQNCAEYWGGGFW 205

  Fly   280 WYGRECFESNLFGTFQS----KYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPL 331
            :|...|.::.|...:.:    |..|.     |..|.:::..|. :|...:|::|.|
 Frog   206 YYSNGCADAGLNARYINPNTLKSPQH-----GFSWVTWVEYPE-TLRASQMMMRRL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 74/234 (32%)
XB5913531XP_012826224.3 FReD 33..255 CDD:238040 72/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.