DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and fgl1a

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_002940496.2 Gene:fgl1a / 100486005 XenbaseID:XB-GENE-979409 Length:313 Species:Xenopus tropicalis


Alignment Length:337 Identity:104/337 - (30%)
Similarity:151/337 - (44%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LPGKHFSVIMRNSAEPFLLAENDTASCPVSTLAGLAARVQFMTDELQNLKTELNELQGLIEEYKN 87
            ||  :.:|||.....|.|..|    ||....|. |.|:|:.:.::   :|.:..::|.|::|.:.
 Frog     7 LP--YMAVIMALFGSPSLALE----SCLQEQLR-LQAQVRLLENQ---VKVQQIKIQNLLQEKEL 61

  Fly    88 QGTGIPIATRLLRPLPASVQTFPLALATPPDDTPRNC---YDEKHGQ---VRIRIAPDMEPFFAS 146
            |........|::......|..              :|   |::.|.|   .:|:.....:.|:|.
 Frog    62 QLMDRGDENRVINLAEKRVYA--------------DCAEIYNDGHKQSAFYKIKPLQSTDSFYAF 112

  Fly   147 CDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNS---EFFIGLDKLHRLTNSEHHELLII 208
            ||.. ..|||.|...|.|||::||::|..||.|||...|   |:::|.|.||.||....:.|.:.
 Frog   113 CDMS-EGGGWTVFQRRSDGSQNFNRNWTEYKQGFGDFTSAKGEYWLGNDNLHYLTLQGDYILRVE 176

  Fly   209 MKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYH-----------AGKKFTTFDQ 262
            :....|:.|||.|..||:|.|...|.: ..|.|.|.||||:...           :|.||:|.|:
 Frog   177 LVDFEGQRRFAQYKSFSVGDEETSYQM-SCGEYTGTAGDSITAGFNPEVTWWANLSGMKFSTQDR 240

  Fly   263 DNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFK---------GILWKSFLPGPT 318
            |||:...|||....|.||:.| |..:||.|          .|:|         ||:|.:: .|..
 Frog   241 DNDNYEGNCAEEDKGGWWFNR-CHAANLNG----------WYYKGPYTSKTDDGIVWYTW-HGWW 293

  Fly   319 GSLSYVRMLIRP 330
            .||..|.|.|||
 Frog   294 YSLKSVTMKIRP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 83/241 (34%)
fgl1aXP_002940496.2 FReD 81..305 CDD:238040 81/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.