DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and LOC100334800

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001315009.1 Gene:LOC100334800 / 100334800 -ID:- Length:246 Species:Danio rerio


Alignment Length:225 Identity:78/225 - (34%)
Similarity:117/225 - (52%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PD--DTPRNCYD-EKHGQVRIR---IAPDMEPFFASC-----DQKVRDGGWMVIAYRFDGSEDFN 170
            ||  ..|.:|.| .:.|:...|   :..|..|....|     .::...|||.||..|.|||.:|.
Zfish    22 PDYRSRPCDCSDLHRSGERSSRTHTVYIDDSPINVDCHMISEGREDEHGGWTVIQKRMDGSLNFY 86

  Fly   171 KDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLL 235
            :.|:.||.|||....|.::||:.:||:|.::.:.|.:.::...|.:..|.|..||:..|.:.|.|
Zfish    87 RPWKEYKRGFGTPEGEHWLGLENIHRITRNKKYMLRVDIEDFGGRKGCAHYSSFSVDCEEDGYKL 151

  Fly   236 YVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQ 300
            :|.|...|.|||||..|..:||:|||:|.||..:||||...|.:|| ::|..:|..|.:  .:|.
Zfish   152 HVSGFRDGGAGDSLSSHNNQKFSTFDKDQDDYKKNCAREFLGGFWY-KKCHHANPNGVY--LWGH 213

  Fly   301 E-IGYFKGILWKSFLPGPTGSLSYVRMLIR 329
            : ..|..|:.|.|:......||.|:.|.|:
Zfish   214 DRTHYAIGVCWWSWDHNYYNSLKYISMKIK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 76/221 (34%)
LOC100334800NP_001315009.1 FReD 28..245 CDD:238040 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.