DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl1

DIOPT Version :10

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001123408.1 Gene:angptl1 / 100170184 XenbaseID:XB-GENE-482123 Length:487 Species:Xenopus tropicalis


Alignment Length:144 Identity:31/144 - (21%)
Similarity:46/144 - (31%) Gaps:52/144 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PSSIALFSILLISIQQTLACVDILFVIDNKTLEVSRSRAIQVAKE-------------------- 131
            |.::| ..::|.::.|.        ::.||.| :.|.|.:...||                    
 Frog    20 PDAVA-HPLILEAVHQQ--------ILSNKFL-IVRMRELLWRKEDCQRFYREHEGRFFYQRLVE 74

  Fly   132 -----------LPEDQKIRKWVVLS------RNDRYVPRVLRNNAELQTVLNTIHGDYDRFLEIA 179
                       |.....|:.|..|.      |.....|..:|.:..|....||.||. |..:. |
 Frog    75 FMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGS-DSVVS-A 137

  Fly   180 TGEIARRTATFQPF 193
            :.|||   |.|..|
 Frog   138 SREIA---AFFPDF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 24/112 (21%)
angptl1NP_001123408.1 cc_LAMB_C 108..169 CDD:424069 15/46 (33%)
FReD 271..486 CDD:238040
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.