DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and fga

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_002933535.3 Gene:fga / 100038060 XenbaseID:XB-GENE-478771 Length:761 Species:Xenopus tropicalis


Alignment Length:245 Identity:85/245 - (34%)
Similarity:130/245 - (53%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DDTPRNCYD--EKH------GQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQ 174
            |.|.::|.|  :||      |..:||.....:.....|||..:.|||::|..|.|||.:||:.||
 Frog   521 DYTGKDCDDIRQKHSSGAKSGIFKIRPEGSTKVLSVYCDQDTQLGGWILIQQRQDGSVNFNRTWQ 585

  Fly   175 NYKAGFGALNS----EFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLL 235
            :||.|||::::    |.::|.:.:|.||..: ..|.|.::..|||:.:|.| :..:|||:|.:.|
 Frog   586 DYKNGFGSVDAGGKGEVWLGNENIHLLTQKD-TILRIELEDWSGEKVYAEY-NIQLGSEAEGFTL 648

  Fly   236 YVLGAYKGDAGDSL--------RY--HAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNL 290
            .| ..|:|.|||:|        .|  |...||:|:|:|:|...:|||..:.|.||| ..|..|||
 Frog   649 KV-SQYEGTAGDALIEGSKEDGEYTSHINMKFSTYDRDSDKWEENCAEMYGGGWWY-NNCQASNL 711

  Fly   291 FGTF--------QSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPLK 332
            .|.:        ::.:..||.  .|::|..| .....||..|||.:||::
 Frog   712 NGIYYIGGQYDPRNNFPYEIE--NGVVWVPF-KAADYSLKTVRMKMRPVE 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 83/241 (34%)
fgaXP_002933535.3 Fib_alpha 51..191 CDD:400857
Fibrinogen_aC 299..372 CDD:403400
FReD 523..757 CDD:238040 83/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.