DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and LOC100007488

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:207 Identity:76/207 - (36%)
Similarity:111/207 - (53%) Gaps:16/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DTPRNCYD-EKHGQ-----VRIRIAPDMEPFFASC----DQKVRD-GGWMVIAYRFDGSEDFNKD 172
            |.|.:|.| .|.||     ..|..|.|. |.:..|    :.|..| |||.||..|.|||.:|.:.
Zfish    25 DKPFDCSDIYKSGQNLSGIYSIYPAGDF-PVWVYCQMVSEGKDEDKGGWTVIQRRMDGSVNFYRP 88

  Fly   173 WQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYV 237
            |::||.|||.:..|:::||:.|::||..:...|.:.::...|...||.|..||:|.|.|.|.|.|
Zfish    89 WRDYKRGFGKVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQV 153

  Fly   238 LGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQE- 301
            .|...|.|||.|..|...||:|||:|.|.:.::||:.:.|.:||| .|..:|..|.:  .:|:: 
Zfish   154 SGFTDGGAGDCLSGHNDLKFSTFDKDQDTHEKSCAKEYLGGFWYG-SCHNTNPNGVY--LWGEDP 215

  Fly   302 IGYFKGILWKSF 313
            ..|..|:.|.::
Zfish   216 THYAIGVCWSTW 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 76/207 (37%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 76/207 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.